Lineage for d2axza1 (2axz A:1-69)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1268060Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 1268061Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 1268438Family a.35.1.11: PrgX N-terminal domain-like [140526] (1 protein)
    Part of Pfam PF01381
  6. 1268439Protein PrgX [140527] (1 species)
    possibly involved in pheromone-inducible conjugation
  7. 1268440Species Enterococcus faecalis [TaxId:1351] [140528] (7 PDB entries)
    Uniprot Q04114 1-69! Uniprot Q04114 2-66
  8. 1268471Domain d2axza1: 2axz A:1-69 [127536]
    Other proteins in same PDB: d2axza2, d2axzb2, d2axzc2, d2axzd2
    automatically matched to 2AW6 A:1-69
    protein/DNA complex

Details for d2axza1

PDB Entry: 2axz (more details), 3 Å

PDB Description: Crystal structure of PrgX/cCF10 complex
PDB Compounds: (A:) PrgX

SCOPe Domain Sequences for d2axza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2axza1 a.35.1.11 (A:1-69) PrgX {Enterococcus faecalis [TaxId: 1351]}
mfkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffe
ilnragmnt

SCOPe Domain Coordinates for d2axza1:

Click to download the PDB-style file with coordinates for d2axza1.
(The format of our PDB-style files is described here.)

Timeline for d2axza1: