![]() | Class a: All alpha proteins [46456] (285 folds) |
![]() | Fold a.145: Flagellar transcriptional activator FlhD [63591] (1 superfamily) multihelical; forms intertwined dimer of identical 5-helical subunits |
![]() | Superfamily a.145.1: Flagellar transcriptional activator FlhD [63592] (1 family) ![]() |
![]() | Family a.145.1.1: Flagellar transcriptional activator FlhD [63593] (1 protein) contains an HTH motif |
![]() | Protein Flagellar transcriptional activator FlhD [63594] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [63595] (3 PDB entries) |
![]() | Domain d2avud_: 2avu D: [127386] Other proteins in same PDB: d2avue1, d2avuf_ automated match to d1g8ea_ complexed with zn |
PDB Entry: 2avu (more details), 3 Å
SCOPe Domain Sequences for d2avud_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2avud_ a.145.1.1 (D:) Flagellar transcriptional activator FlhD {Escherichia coli [TaxId: 562]} tsellkhiydinlsylllaqrlivqdkasamfrlgineemattlaaltlpqmvklaetnq lvchfrfdshqtitqltqdsrvddlqqihtgimlstrllndvnq
Timeline for d2avud_: