Lineage for d2avud_ (2avu D:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.145: Flagellar transcriptional activator FlhD [63591] (1 superfamily)
    multihelical; forms intertwined dimer of identical 5-helical subunits
  4. Superfamily a.145.1: Flagellar transcriptional activator FlhD [63592] (1 family) (S)
  5. Family a.145.1.1: Flagellar transcriptional activator FlhD [63593] (1 protein)
    contains an HTH motif
  6. Protein Flagellar transcriptional activator FlhD [63594] (1 species)
  7. Species Escherichia coli [TaxId:562] [63595] (3 PDB entries)
  8. Domain d2avud_: 2avu D: [127386]
    Other proteins in same PDB: d2avue1, d2avuf_
    automated match to d1g8ea_
    complexed with zn

Details for d2avud_

PDB Entry: 2avu (more details), 3 Å

PDB Description: Structure of the Escherichia coli FlhDC complex, a prokaryotic heteromeric regulator of transcription
PDB Compounds: (D:) Transcriptional activator flhD

SCOPe Domain Sequences for d2avud_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2avud_ a.145.1.1 (D:) Flagellar transcriptional activator FlhD {Escherichia coli [TaxId: 562]}
tsellkhiydinlsylllaqrlivqdkasamfrlgineemattlaaltlpqmvklaetnq
lvchfrfdshqtitqltqdsrvddlqqihtgimlstrllndvnq

SCOPe Domain Coordinates for d2avud_ are not available.

Timeline for d2avud_:

Domains from other chains:
(mouse over for more information)
d2avua_, d2avub_, d2avuc_, d2avue1, d2avuf_