Lineage for d2avga1 (2avg A:1-110)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2364875Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 2364888Protein Cardiac myosin binding protein C, different domains [89185] (1 species)
  7. 2364889Species Human (Homo sapiens) [TaxId:9606] [89186] (5 PDB entries)
    Uniprot Q14896 358-451, 641-770
  8. 2364893Domain d2avga1: 2avg A:1-110 [127379]

Details for d2avga1

PDB Entry: 2avg (more details)

PDB Description: nmr structure of cc1 domain from human cardiac myosin binding protein c
PDB Compounds: (A:) Myosin-binding protein C, cardiac-type

SCOPe Domain Sequences for d2avga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2avga1 b.1.1.4 (A:1-110) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]}
ddpiglfvmrpqdgevtvggsitfsarvagasllkppvvkwfkgkwvdlsskvgqhlqlh
dsydraskvylfelhitdaqpaftggyrcevstkdkfdcsnfnltvheam

SCOPe Domain Coordinates for d2avga1:

Click to download the PDB-style file with coordinates for d2avga1.
(The format of our PDB-style files is described here.)

Timeline for d2avga1: