Lineage for d2avga1 (2avg A:1-110)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 656838Family b.1.1.4: I set domains [49159] (36 proteins)
  6. 656851Protein Cardiac myosin binding protein C, different domains [89185] (1 species)
  7. 656852Species Human (Homo sapiens) [TaxId:9606] [89186] (3 PDB entries)
  8. 656854Domain d2avga1: 2avg A:1-110 [127379]

Details for d2avga1

PDB Entry: 2avg (more details)

PDB Description: NMR structure of cC1 domain from Human Cardiac Myosin Binding Protein C
PDB Compounds: (A:) Myosin-binding protein C, cardiac-type

SCOP Domain Sequences for d2avga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2avga1 b.1.1.4 (A:1-110) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]}
ddpiglfvmrpqdgevtvggsitfsarvagasllkppvvkwfkgkwvdlsskvgqhlqlh
dsydraskvylfelhitdaqpaftggyrcevstkdkfdcsnfnltvheam

SCOP Domain Coordinates for d2avga1:

Click to download the PDB-style file with coordinates for d2avga1.
(The format of our PDB-style files is described here.)

Timeline for d2avga1: