Lineage for d2av9g_ (2av9 G:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1646047Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 1646048Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 1646049Family d.38.1.1: 4HBT-like [54638] (19 proteins)
    Pfam PF03061
  6. 1646155Protein automated matches [190155] (2 species)
    not a true protein
  7. 1646163Species Pseudomonas aeruginosa [TaxId:208964] [187318] (1 PDB entry)
  8. 1646169Domain d2av9g_: 2av9 G: [127371]
    Other proteins in same PDB: d2av9a1
    automated match to d2av9a1
    complexed with so4

Details for d2av9g_

PDB Entry: 2av9 (more details), 2.4 Å

PDB Description: crystal structure of the pa5185 protein from pseudomonas aeruginosa strain pao1.
PDB Compounds: (G:) thioesterase

SCOPe Domain Sequences for d2av9g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2av9g_ d.38.1.1 (G:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
lreqylhfqpistrwhdndiyghvnnvtyyaffdtavntylierggldiqggeviglvvs
sscdyfapvafpqriemglrvarlgnssvqyelalflegqreacaagrfvhvfverrssr
pvaipqelrdalaalq

SCOPe Domain Coordinates for d2av9g_:

Click to download the PDB-style file with coordinates for d2av9g_.
(The format of our PDB-style files is described here.)

Timeline for d2av9g_: