![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
![]() | Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (8 families) ![]() |
![]() | Family d.38.1.1: 4HBT-like [54638] (16 proteins) Pfam PF03061 |
![]() | Protein Hypothetical thioesterase PA5185 [143158] (1 species) |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [143159] (1 PDB entry) |
![]() | Domain d2av9g1: 2av9 G:8-143 [127371] automatically matched to 2AV9 A:5-146 complexed with so4 |
PDB Entry: 2av9 (more details), 2.4 Å
SCOP Domain Sequences for d2av9g1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2av9g1 d.38.1.1 (G:8-143) Hypothetical thioesterase PA5185 {Pseudomonas aeruginosa [TaxId: 287]} lreqylhfqpistrwhdndiyghvnnvtyyaffdtavntylierggldiqggeviglvvs sscdyfapvafpqriemglrvarlgnssvqyelalflegqreacaagrfvhvfverrssr pvaipqelrdalaalq
Timeline for d2av9g1: