SCOPe 2.06: Domain d2aunb2: 2aun B:7-142

Lineage for d2aunb2 (2aun B:7-142)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures

5. Family c.23.16.7: LD-carboxypeptidase A N-terminal domain-like [142074] (1 protein)
   N-terminal half of Pfam PF02016

6. Protein LD-carboxypeptidase A, N-terminal domain [142075] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [142076] (4 PDB entries)
   Uniprot Q9HTZ1 3-169! Uniprot Q9HTZ1 5-142! Uniprot Q9HTZ1 5-169

8. Domain d2aunb2: 2aun B:7-142 [127337]
   Other proteins in same PDB: d2auna1, d2aunb1
   automated match to d2auna2
   mutant

Details for d2aunb2

PDB Entry: 2aun, 2.4 Å

PDB Description: active site his285ala mutant of ld-carboxypeptidase

PDB Compounds: (B:) hypothetical protein

SCOPe Domain Sequences for d2aunb2:

Sequence; same for both SEQRES and ATOM records:

>d2aunb2 c.23.16.7 (B:7-142) LD-carboxypeptidase A, N-terminal domain {Pseudomonas aeruginosa [TaxId: 287]}
sdqtwqpidgrvaliapasaiatevleatlrqlevhgvdyhlgrhvearyrylagtveqr
ledlhnafdmpditavwclrggygcgqllpgldwgrleaasprpligfsdisvllsafhr
hglpaihgpvatglgl

Timeline for d2aunb2:

• d2aunb2 first appeared in SCOP 1.73
  
• d2aunb2 appears in SCOPe 2.05
  
• d2aunb2 appears in SCOPe 2.07
  
• d2aunb2 appears in the current release, SCOPe 2.08