SCOPe 2.06: Domain d2aunb1: 2aun B:152-307

Lineage for d2aunb1 (2aun B:152-307)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
   3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
   this domain is thought to be mobile in most multi-domain proteins known to contain it

4. Superfamily c.8.10: LD-carboxypeptidase A C-terminal domain-like [141986] (1 family)

5. Family c.8.10.1: LD-carboxypeptidase A C-terminal domain-like [141987] (1 protein)
   C-terminal half of Pfam PF02016

6. Protein LD-carboxypeptidase A, C-terminal domain [141988] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [141989] (4 PDB entries)
   Uniprot Q9HTZ1 152-307! Uniprot Q9HTZ1 170-307

8. Domain d2aunb1: 2aun B:152-307 [127336]
   Other proteins in same PDB: d2auna2, d2aunb2
   automated match to d2auna1
   mutant

Details for d2aunb1

PDB Entry: 2aun, 2.4 Å

PDB Description: active site his285ala mutant of ld-carboxypeptidase

PDB Compounds: (B:) hypothetical protein

SCOPe Domain Sequences for d2aunb1:

Sequence; same for both SEQRES and ATOM records:

>d2aunb1 c.8.10.1 (B:152-307) LD-carboxypeptidase A, C-terminal domain {Pseudomonas aeruginosa [TaxId: 287]}
qerlaslasvsrllagidhelpvqhlgghkqrvegaliggnltalacmagtlgglhapag
silvledvgepyyrlerslwqllesidarqlgaiclgsftdcprkevahslerifgeyaa
aievplyhhlpsgagaqnrawpygktavlegnrlrw

Timeline for d2aunb1:

• d2aunb1 first appeared in SCOP 1.73
  
• d2aunb1 appears in SCOPe 2.05
  
• d2aunb1 appears in SCOPe 2.07
  
• d2aunb1 appears in the current release, SCOPe 2.08