Class b: All beta proteins [48724] (165 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (8 families) bind hydrophobic ligands in their interior |
Family b.60.1.1: Retinol binding protein-like [50815] (20 proteins) barrel, closed; n=8, S=12, meander |
Protein Nitrophorin 4 [50845] (1 species) |
Species Rhodnius prolixus [TaxId:13249] [50846] (31 PDB entries) |
Domain d2at7x1: 2at7 X:1-184 [127283] automatically matched to d1d2ua_ complexed with fdd, nh4 |
PDB Entry: 2at7 (more details), 0.98 Å
SCOP Domain Sequences for d2at7x1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2at7x1 b.60.1.1 (X:1-184) Nitrophorin 4 {Rhodnius prolixus [TaxId: 13249]} actknaiaqtgfnkdkyfngdvwyvtdyldlepddvpkrycaalaagtasgklkealyhy dpktqdtfydvselqveslgkytanfkkvdkngnvkvavtagnyytftvmyaddssalih tclhkgnkdlgdlyavlnrnkdaaagdkvksavsaatlefskfistkenncaydndslks lltk
Timeline for d2at7x1: