Lineage for d1d2ua_ (1d2u A:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 673645Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 673646Superfamily b.60.1: Lipocalins [50814] (8 families) (S)
    bind hydrophobic ligands in their interior
  5. 673647Family b.60.1.1: Retinol binding protein-like [50815] (20 proteins)
    barrel, closed; n=8, S=12, meander
  6. 673811Protein Nitrophorin 4 [50845] (1 species)
  7. 673812Species Rhodnius prolixus [TaxId:13249] [50846] (31 PDB entries)
  8. 673831Domain d1d2ua_: 1d2u A: [64773]
    complexed with hem, nh3

Details for d1d2ua_

PDB Entry: 1d2u (more details), 1.15 Å

PDB Description: 1.15 a crystal structure of nitrophorin 4 from rhodnius prolixus
PDB Compounds: (A:) Nitrophorin 4

SCOP Domain Sequences for d1d2ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d2ua_ b.60.1.1 (A:) Nitrophorin 4 {Rhodnius prolixus [TaxId: 13249]}
actknaiaqtgfnkdkyfngdvwyvtdyldlepddvpkrycaalaagtasgklkealyhy
dpktqdtfydvselqveslgkytanfkkvdkngnvkvavtagnyytftvmyaddssalih
tclhkgnkdlgdlyavlnrnkdaaagdkvksavsaatlefskfistkenncaydndslks
lltk

SCOP Domain Coordinates for d1d2ua_:

Click to download the PDB-style file with coordinates for d1d2ua_.
(The format of our PDB-style files is described here.)

Timeline for d1d2ua_: