Lineage for d2assb1 (2ass B:2095-2133)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2017863Fold a.158: F-box domain [81385] (1 superfamily)
    multihelical; interlocked heterodimer with the Skp1 dimerisation domain
  4. 2017864Superfamily a.158.1: F-box domain [81383] (1 family) (S)
  5. 2017865Family a.158.1.1: F-box domain [81381] (4 proteins)
  6. 2017880Protein Skp2 [81379] (1 species)
  7. 2017881Species Human (Homo sapiens) [TaxId:9606] [81377] (6 PDB entries)
  8. 2017885Domain d2assb1: 2ass B:2095-2133 [127270]
    Other proteins in same PDB: d2assa1, d2assa2, d2assb2, d2assc_
    automated match to d1fqva1
    complexed with ben, po4

Details for d2assb1

PDB Entry: 2ass (more details), 3 Å

PDB Description: crystal structure of the skp1-skp2-cks1 complex
PDB Compounds: (B:) S-phase kinase-associated protein 2

SCOPe Domain Sequences for d2assb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2assb1 a.158.1.1 (B:2095-2133) Skp2 {Human (Homo sapiens) [TaxId: 9606]}
vswdslpdelllgifsclclpellkvsgvckrwyrlasd

SCOPe Domain Coordinates for d2assb1:

Click to download the PDB-style file with coordinates for d2assb1.
(The format of our PDB-style files is described here.)

Timeline for d2assb1: