Lineage for d2asqa_ (2asq A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2931198Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2931473Protein SUMO-1 (smt3 homologue) [54241] (3 species)
  7. 2931481Species Human (Homo sapiens) [TaxId:9606] [54242] (10 PDB entries)
    Uniprot Q93068
  8. 2931489Domain d2asqa_: 2asq A: [127269]
    automated match to d1a5ra_

Details for d2asqa_

PDB Entry: 2asq (more details)

PDB Description: solution structure of sumo-1 in complex with a sumo-binding motif (sbm)
PDB Compounds: (A:) Small ubiquitin-related modifier 1

SCOPe Domain Sequences for d2asqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2asqa_ d.15.1.1 (A:) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]}
yiklkvigqdsseihfkvkmtthlkklkesycqrqgvpmnslrflfegqriadnhtpkel
gmeeedvievyqeqtgg

SCOPe Domain Coordinates for d2asqa_:

Click to download the PDB-style file with coordinates for d2asqa_.
(The format of our PDB-style files is described here.)

Timeline for d2asqa_: