SCOP 1.73: Domain d2asqa1: 2asq A:21-97

Lineage for d2asqa1 (2asq A:21-97)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (7 families)

5. Family d.15.1.1: Ubiquitin-related [54237] (38 proteins)
   Pfam PF00240

6. Protein SUMO-1 (smt3 homologue) [54241] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54242] (13 PDB entries)

8. Domain d2asqa1: 2asq A:21-97 [127269]
   automatically matched to d1tgzb_

Details for d2asqa1

PDB Entry: 2asq

PDB Description: solution structure of sumo-1 in complex with a sumo-binding motif (sbm)

PDB Compounds: (A:) Small ubiquitin-related modifier 1

SCOP Domain Sequences for d2asqa1:

Sequence; same for both SEQRES and ATOM records:

>d2asqa1 d.15.1.1 (A:21-97) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]}
yiklkvigqdsseihfkvkmtthlkklkesycqrqgvpmnslrflfegqriadnhtpkel
gmeeedvievyqeqtgg

Timeline for d2asqa1:

• d2asqa1 is new in SCOP 1.73
  
• d2asqa1 appears in SCOP 1.75
  
• d2asqa1 appears in the current release, SCOPe 2.08, called d2asqa_