Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (7 families) |
Family d.15.1.1: Ubiquitin-related [54237] (38 proteins) Pfam PF00240 |
Protein SUMO-1 (smt3 homologue) [54241] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [54242] (13 PDB entries) |
Domain d2asqa1: 2asq A:21-97 [127269] automatically matched to d1tgzb_ |
PDB Entry: 2asq (more details)
SCOP Domain Sequences for d2asqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2asqa1 d.15.1.1 (A:21-97) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]} yiklkvigqdsseihfkvkmtthlkklkesycqrqgvpmnslrflfegqriadnhtpkel gmeeedvievyqeqtgg
Timeline for d2asqa1: