SCOPe 2.08: Domain d2asnx2: 2asn X:2-179

Lineage for d2asnx2 (2asn X:2-179)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein Nitrophorin 2 (prolixin-s) [50843] (1 species)

7. Species Rhodnius prolixus [TaxId:13249] [50844] (14 PDB entries)
   Uniprot Q26241

8. Domain d2asnx2: 2asn X:2-179 [127264]
   Other proteins in same PDB: d2asnx3
   automated match to d1euoa_
   complexed with hem, imd; mutant

Details for d2asnx2

PDB Entry: 2asn, 1.7 Å

PDB Description: Crystal structure of D1A mutant of nitrophorin 2 complexed with imidazole

PDB Compounds: (X:) Nitrophorin 2

SCOPe Domain Sequences for d2asnx2:

Sequence; same for both SEQRES and ATOM records:

>d2asnx2 b.60.1.1 (X:2-179) Nitrophorin 2 (prolixin-s) {Rhodnius prolixus [TaxId: 13249]}
cstnispkqgldkakyfsgkwyvthfldkdpqvtdqycssftpresdgtvkealyhynan
kktsfynigegklessglqytakyktvdkkkavlkeadeknsytltvleaddssalvhic
lregskdlgdlytvlthqkdaepsakvksavtqaglqlsqfvgtkdlgcqyddqftsl

Timeline for d2asnx2:

• d2asnx2 first appeared in SCOP 1.73, called d2asnx1
  
• d2asnx2 appears in SCOPe 2.07