Lineage for d2asea1 (2ase A:1-178)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2866774Protein CDC42 [52619] (2 species)
  7. 2866775Species Human (Homo sapiens) [TaxId:9606] [52620] (34 PDB entries)
  8. 2866820Domain d2asea1: 2ase A:1-178 [127252]
    mutant

Details for d2asea1

PDB Entry: 2ase (more details)

PDB Description: nmr structure of the f28l mutant of cdc42hs
PDB Compounds: (A:) Cell division control protein 42 homolog

SCOPe Domain Sequences for d2asea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2asea1 c.37.1.8 (A:1-178) CDC42 {Human (Homo sapiens) [TaxId: 9606]}
mqtikcvvvgdgavgktcllisyttnklpseyvptvfdnyavtvmiggepytlglfdtag
qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaale

SCOPe Domain Coordinates for d2asea1:

Click to download the PDB-style file with coordinates for d2asea1.
(The format of our PDB-style files is described here.)

Timeline for d2asea1: