Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (24 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.3: Calpain large subunit, catalytic domain (domain II) [54040] (1 protein) automatically mapped to Pfam PF00648 |
Protein Calpain large subunit, catalytic domain (domain II) [54041] (6 species) includes the N-terminal 'sequence' domain I |
Species Human (Homo sapiens), mu type [TaxId:9606] [142851] (2 PDB entries) Uniprot P07384 33-353! Uniprot P07384 33-354 |
Domain d2arya1: 2ary A:33-354 [127223] complexed with bme, ca |
PDB Entry: 2ary (more details), 2.4 Å
SCOPe Domain Sequences for d2arya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2arya1 d.3.1.3 (A:33-354) Calpain large subunit, catalytic domain (domain II) {Human (Homo sapiens), mu type [TaxId: 9606]} naikylgqdyeqlrvrclqsgtlfrdeafppvpqslgykdlgpnssktygikwkrptell snpqfivdgatrtdicqgalgdcwllaaiasltlndtllhrvvphgqsfqngyagifhfq lwqfgewvdvvvddllpikdgklvfvhsaegnefwsallekayakvngsyealsggstse gfedftggvtewyelrkapsdlyqiilkalergsllgcsidissvldmeaitfkklvkgh aysvtgakqvnyrgqvvslirmrnpwgevewtgawsdsssewnnvdpyerdqlrvkmedg efwmsfrdfmreftrleicnlt
Timeline for d2arya1: