Lineage for d2arya1 (2ary A:33-354)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2926589Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2926590Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2927079Family d.3.1.3: Calpain large subunit, catalytic domain (domain II) [54040] (1 protein)
    automatically mapped to Pfam PF00648
  6. 2927080Protein Calpain large subunit, catalytic domain (domain II) [54041] (6 species)
    includes the N-terminal 'sequence' domain I
  7. 2927089Species Human (Homo sapiens), mu type [TaxId:9606] [142851] (2 PDB entries)
    Uniprot P07384 33-353! Uniprot P07384 33-354
  8. 2927090Domain d2arya1: 2ary A:33-354 [127223]
    complexed with bme, ca

Details for d2arya1

PDB Entry: 2ary (more details), 2.4 Å

PDB Description: Catalytic domain of Human Calpain-1
PDB Compounds: (A:) Calpain-1 catalytic subunit

SCOPe Domain Sequences for d2arya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2arya1 d.3.1.3 (A:33-354) Calpain large subunit, catalytic domain (domain II) {Human (Homo sapiens), mu type [TaxId: 9606]}
naikylgqdyeqlrvrclqsgtlfrdeafppvpqslgykdlgpnssktygikwkrptell
snpqfivdgatrtdicqgalgdcwllaaiasltlndtllhrvvphgqsfqngyagifhfq
lwqfgewvdvvvddllpikdgklvfvhsaegnefwsallekayakvngsyealsggstse
gfedftggvtewyelrkapsdlyqiilkalergsllgcsidissvldmeaitfkklvkgh
aysvtgakqvnyrgqvvslirmrnpwgevewtgawsdsssewnnvdpyerdqlrvkmedg
efwmsfrdfmreftrleicnlt

SCOPe Domain Coordinates for d2arya1:

Click to download the PDB-style file with coordinates for d2arya1.
(The format of our PDB-style files is described here.)

Timeline for d2arya1: