SCOPe 2.08: Domain d2aryb_: 2ary B:

Lineage for d2aryb_ (2ary B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.3: Calpain large subunit, catalytic domain (domain II) [54040] (1 protein)
   automatically mapped to Pfam PF00648

6. Protein Calpain large subunit, catalytic domain (domain II) [54041] (6 species)
   includes the N-terminal 'sequence' domain I

7. Species Human (Homo sapiens), mu type [TaxId:9606] [142851] (2 PDB entries)
   Uniprot P07384 33-353! Uniprot P07384 33-354

8. Domain d2aryb_: 2ary B: [127224]
   automated match to d2arya1
   complexed with bme, ca

Details for d2aryb_

PDB Entry: 2ary, 2.4 Å

PDB Description: Catalytic domain of Human Calpain-1

PDB Compounds: (B:) Calpain-1 catalytic subunit

SCOPe Domain Sequences for d2aryb_:

Sequence; same for both SEQRES and ATOM records:

>d2aryb_ d.3.1.3 (B:) Calpain large subunit, catalytic domain (domain II) {Human (Homo sapiens), mu type [TaxId: 9606]}
naikylgqdyeqlrvrclqsgtlfrdeafppvpqslgykdlgpnssktygikwkrptell
snpqfivdgatrtdicqgalgdcwllaaiasltlndtllhrvvphgqsfqngyagifhfq
lwqfgewvdvvvddllpikdgklvfvhsaegnefwsallekayakvngsyealsggstse
gfedftggvtewyelrkapsdlyqiilkalergsllgcsidissvldmeaitfkklvkgh
aysvtgakqvnyrgqvvslirmrnpwgevewtgawsdsssewnnvdpyerdqlrvkmedg
efwmsfrdfmreftrleicnlt

Timeline for d2aryb_:

• d2aryb_ first appeared in SCOP 1.73, called d2aryb1
  
• d2aryb_ appears in SCOPe 2.07