SCOP 1.75: Domain d2aq3d2: 2aq3 D:124-235

Lineage for d2aq3d2 (2aq3 D:124-235)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family)

5. Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (15 proteins)

6. Protein Streptococcal superantigen SSA [54354] (1 species)

7. Species Streptococcus pyogenes [TaxId:1314] [54355] (4 PDB entries)

8. Domain d2aq3d2: 2aq3 D:124-235 [127151]
   Other proteins in same PDB: d2aq3a1, d2aq3b1, d2aq3c1, d2aq3d1, d2aq3e1, d2aq3f1, d2aq3g1, d2aq3h1
   automatically matched to d1bxta2
   mutant

Details for d2aq3d2

PDB Entry: 2aq3, 2.3 Å

PDB Description: Crystal structure of T-cell receptor V beta domain variant complexed with superantigen SEC3

PDB Compounds: (D:) Enterotoxin type C-3

SCOP Domain Sequences for d2aq3d2:

Sequence; same for both SEQRES and ATOM records:

>d2aq3d2 d.15.6.1 (D:124-235) Streptococcal superantigen SSA {Streptococcus pyogenes [TaxId: 1314]}
gnlqnvlvrvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnsspyetgy
ikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttk

Timeline for d2aq3d2:

• d2aq3d2 first appeared in SCOP 1.73
  
• d2aq3d2 appears in SCOPe 2.01
  
• d2aq3d2 appears in the current release, SCOPe 2.08