Lineage for d2aq3f2 (2aq3 F:124-235)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 853596Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 854470Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) (S)
  5. 854471Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (15 proteins)
  6. 854601Protein Streptococcal superantigen SSA [54354] (1 species)
  7. 854602Species Streptococcus pyogenes [TaxId:1314] [54355] (4 PDB entries)
  8. 854612Domain d2aq3f2: 2aq3 F:124-235 [127153]
    Other proteins in same PDB: d2aq3a1, d2aq3b1, d2aq3c1, d2aq3d1, d2aq3e1, d2aq3f1, d2aq3g1, d2aq3h1
    automatically matched to d1bxta2
    mutant

Details for d2aq3f2

PDB Entry: 2aq3 (more details), 2.3 Å

PDB Description: Crystal structure of T-cell receptor V beta domain variant complexed with superantigen SEC3
PDB Compounds: (F:) Enterotoxin type C-3

SCOP Domain Sequences for d2aq3f2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aq3f2 d.15.6.1 (F:124-235) Streptococcal superantigen SSA {Streptococcus pyogenes [TaxId: 1314]}
gnlqnvlvrvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnsspyetgy
ikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttk

SCOP Domain Coordinates for d2aq3f2:

Click to download the PDB-style file with coordinates for d2aq3f2.
(The format of our PDB-style files is described here.)

Timeline for d2aq3f2: