![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins) |
![]() | Protein T-cell antigen receptor [48933] (6 species) sequences may differ within each classified species |
![]() | Species Mouse (Mus musculus), beta-chain [TaxId:10090] [48936] (27 PDB entries) |
![]() | Domain d2aq3g1: 2aq3 G:2-117 [144828] Other proteins in same PDB: d2aq3b1, d2aq3b2, d2aq3d1, d2aq3d2, d2aq3f1, d2aq3f2, d2aq3h1, d2aq3h2 automatically matched to 2AQ3 A:2-117 mutant |
PDB Entry: 2aq3 (more details), 2.3 Å
SCOP Domain Sequences for d2aq3g1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aq3g1 b.1.1.1 (G:2-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} aavtqsprnkvavtgekvtlscqqtnnhnnmywyrqdtghglrlihysygagstekgdip dgykasrpsqeqfslilesatpsqtsvyfcasggggtlyfgagtrlsvl
Timeline for d2aq3g1: