SCOPe 2.08: Domain d2aq1b2: 2aq1 B:117-235

Lineage for d2aq1b2 (2aq1 B:117-235)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families)

5. Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)

6. Protein Staphylococcal enterotoxin C3, SEC3 [54344] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [54345] (20 PDB entries)
   Uniprot P23313

8. Domain d2aq1b2: 2aq1 B:117-235 [127139]
   Other proteins in same PDB: d2aq1a_, d2aq1b1, d2aq1c_, d2aq1d1, d2aq1e_, d2aq1f1, d2aq1g_, d2aq1h1
   automated match to d3bzdb2
   mutant

Details for d2aq1b2

PDB Entry: 2aq1, 2.1 Å

PDB Description: crystal structure of t-cell receptor v beta domain variant complexed with superantigen sec3 mutant

PDB Compounds: (B:) Enterotoxin type C-3

SCOPe Domain Sequences for d2aq1b2:

Sequence; same for both SEQRES and ATOM records:

>d2aq1b2 d.15.6.1 (B:117-235) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus [TaxId: 1280]}
egnhfdngnlqnvlvrvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefns
spyetgyikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttk

Timeline for d2aq1b2:

• d2aq1b2 first appeared in SCOP 1.73
  
• d2aq1b2 appears in SCOPe 2.07