![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein automated matches [190119] (24 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [186842] (616 PDB entries) |
![]() | Domain d2aq1c_: 2aq1 C: [161386] Other proteins in same PDB: d2aq1b1, d2aq1b2, d2aq1d1, d2aq1d2, d2aq1f1, d2aq1f2, d2aq1h1, d2aq1h2 automated match to d2aq2a1 mutant |
PDB Entry: 2aq1 (more details), 2.1 Å
SCOPe Domain Sequences for d2aq1c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aq1c_ b.1.1.1 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} aavtqsprnkvavtgekvtlscqqtnnhnnmywyrqdtghglrlihysygvgntekgdip dgyeasrpsqeqfslilvsatpsqssvyfcasgvggtlyfgagtrlsvl
Timeline for d2aq1c_: