![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) ![]() |
![]() | Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (14 proteins) |
![]() | Protein Streptococcal superantigen SSA [54354] (1 species) |
![]() | Species Streptococcus pyogenes [TaxId:1314] [54355] (4 PDB entries) |
![]() | Domain d2aq1b2: 2aq1 B:124-235 [127139] Other proteins in same PDB: d2aq1b1, d2aq1d1, d2aq1f1, d2aq1h1 automatically matched to d1bxta2 mutant |
PDB Entry: 2aq1 (more details), 2.1 Å
SCOP Domain Sequences for d2aq1b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aq1b2 d.15.6.1 (B:124-235) Streptococcal superantigen SSA {Streptococcus pyogenes [TaxId: 1314]} gnlqnvlvrvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnsspyetgy ikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttk
Timeline for d2aq1b2: