Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) |
Family c.66.1.19: Histamine methyltransferase [75261] (1 protein) |
Protein Histamine methyltransferase [75262] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [75263] (7 PDB entries) |
Domain d2aotb_: 2aot B: [127099] automated match to d1jqda_ complexed with 2pm, sah |
PDB Entry: 2aot (more details), 1.9 Å
SCOPe Domain Sequences for d2aotb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aotb_ c.66.1.19 (B:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} mrslfsdhgkyvesfrrflnhstehqcmqefmdkklpgiigrigdtkseikilsigggag eidlqilskvqaqypgvcinnevvepsaeqiakykelvaktsnlenvkfawhketsseyq srmlekkelqkwdfihmiqmlyyvkdipatlkffhsllgtnakmliivvsgssgwdklwk kygsrfpqddlcqyitsddltqmldnlglkyecydllstmdisdcfidgnengdllwdfl tetcnfnatappdlraelgkdlqepefsakkegkvlfnntlsfiviea
Timeline for d2aotb_: