SCOPe 2.08: Domain d2an4b2: 2an4 B:14-280

Lineage for d2an4b2 (2an4 B:14-280)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families)

5. Family c.66.1.15: Arylamine N-methyltransferase [69547] (3 proteins)
   automatically mapped to Pfam PF01234

6. Protein Phenylethanolamine N-methyltransferase, PNMTase [69548] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69549] (8 PDB entries)

8. Domain d2an4b2: 2an4 B:14-280 [127030]
   Other proteins in same PDB: d2an4a3, d2an4b3
   automated match to d1hnnb_
   complexed with otr, po4, sah

Details for d2an4b2

PDB Entry: 2an4, 2.2 Å

PDB Description: Structure of PNMT complexed with S-adenosyl-L-homocysteine and the acceptor substrate octopamine

PDB Compounds: (B:) Phenylethanolamine N-methyltransferase

SCOPe Domain Sequences for d2an4b2:

Sequence; same for both SEQRES and ATOM records:

>d2an4b2 c.66.1.15 (B:14-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]}
pdsapgqaavasayqrfepraylrnnyapprgdlcnpngvgpwklrclaqtfatgevsgr
tlidigsgptvyqllsacshfeditmtdflevnrqelgrwlqeepgafnwsmysqhacli
egkgecwqdkerqlrarvkrvlpidvhqpqplgagspaplpadalvsafcleavspdlas
fqraldhittllrpgghllligaleeswylagearltvvpvseeevrealvrsgykvrdl
rtyimpahlqtgvddvkgvffawaqkv

Timeline for d2an4b2:

• d2an4b2 first appeared in SCOP 1.73, called d2an4b1
  
• d2an4b2 appears in SCOPe 2.07