| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (2 families) ![]() binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
| Family c.1.11.1: Enolase [51605] (1 protein) |
| Protein Enolase [51606] (8 species) Fold of this protein slightly differs from common fold in topology |
| Species Human (Homo sapiens), gamma isoform [TaxId:9606] [110371] (3 PDB entries) Uniprot P09104 |
| Domain d2akmb1: 2akm B:140-432 [126921] Other proteins in same PDB: d2akma2, d2akmb2 automatically matched to d1te6a1 complexed with mg, po4, trs |
PDB Entry: 2akm (more details), 1.92 Å
SCOPe Domain Sequences for d2akmb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2akmb1 c.1.11.1 (B:140-432) Enolase {Human (Homo sapiens), gamma isoform [TaxId: 9606]}
sdlilpvpafnvinggshagnklamqefmilpvgaesfrdamrlgaevyhtlkgvikdky
gkdatnvgdeggfapnilensealelvkeaidkagytekivigmdvaasefyrdgkydld
fksptdpsryitgdqlgalyqdfvrdypvvsiedpfdqddwaawskftanvgiqivgddl
tvtnpkrieraveekacnclllkvnqigsvteaiqacklaqengwgvmvshrsgetedtf
iadlvvglctgqiktgapcrserlakynqlmrieeelgdearfaghnfrnpsv
Timeline for d2akmb1: