Lineage for d2akab1 (2aka B:6-304)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1593542Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1593543Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1594390Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1594659Protein Dynamin G domain [69488] (2 species)
    the family common core is decorated with large insertions
  7. 1594660Species Norway rat (Rattus norvegicus) [TaxId:10116] [142228] (1 PDB entry)
    Uniprot P21575 6-304
    Dynamin-1
  8. 1594661Domain d2akab1: 2aka B:6-304 [126914]

Details for d2akab1

PDB Entry: 2aka (more details), 1.9 Å

PDB Description: Structure of the nucleotide-free myosin II motor domain from Dictyostelium discoideum fused to the GTPase domain of dynamin 1 from Rattus norvegicus
PDB Compounds: (B:) Dynamin-1

SCOPe Domain Sequences for d2akab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
medliplvnrlqdafsaigqnadldlpqiavvggqsagkssvlenfvgrdflprgsgivt
rrplvlqlvnstteyaeflhckgkkftdfeevrleieaetdrvtgtnkgispvpinlrvy
sphvlnltlvdlpgmtkvpvgdqppdiefqirdmlmqfvtkenclilavspansdlansd
alkiakevdpqgqrtigvitkldlmdegtdardvlenkllplrrgyigvvnrsqkdidgk
kditaalaaerkfflshpsyrhladrmgtpylqkvlnqqltnhirdtlpglrnklqsql

SCOPe Domain Coordinates for d2akab1:

Click to download the PDB-style file with coordinates for d2akab1.
(The format of our PDB-style files is described here.)

Timeline for d2akab1: