SCOP 1.73: Domain d2akab1: 2aka B:6-304

Lineage for d2akab1 (2aka B:6-304)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (78 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Dynamin G domain [69488] (2 species)
   the family common core is decorated with large insertions

7. Species Rat (Rattus norvegicus) [TaxId:10116] [142228] (1 PDB entry)
   Dynamin-1

8. Domain d2akab1: 2aka B:6-304 [126914]

Details for d2akab1

PDB Entry: 2aka, 1.9 Å

PDB Description: Structure of the nucleotide-free myosin II motor domain from Dictyostelium discoideum fused to the GTPase domain of dynamin 1 from Rattus norvegicus

PDB Compounds: (B:) Dynamin-1

SCOP Domain Sequences for d2akab1:

Sequence; same for both SEQRES and ATOM records:

>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]}
medliplvnrlqdafsaigqnadldlpqiavvggqsagkssvlenfvgrdflprgsgivt
rrplvlqlvnstteyaeflhckgkkftdfeevrleieaetdrvtgtnkgispvpinlrvy
sphvlnltlvdlpgmtkvpvgdqppdiefqirdmlmqfvtkenclilavspansdlansd
alkiakevdpqgqrtigvitkldlmdegtdardvlenkllplrrgyigvvnrsqkdidgk
kditaalaaerkfflshpsyrhladrmgtpylqkvlnqqltnhirdtlpglrnklqsql

Timeline for d2akab1:

• d2akab1 is new in SCOP 1.73
  
• d2akab1 appears in SCOP 1.75
  
• d2akab1 appears in the current release, SCOPe 2.08