Lineage for d2aizp1 (2aiz P:1-134)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1032069Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 1032694Superfamily d.79.7: OmpA-like [103088] (1 family) (S)
  5. 1032695Family d.79.7.1: OmpA-like [103089] (3 proteins)
    Pfam PF00691
  6. 1032699Protein Peptidoglycan-associated lipoprotein, PAL, periplasmic domain [103090] (2 species)
  7. 1032702Species Haemophilus influenzae [TaxId:727] [143531] (1 PDB entry)
    Uniprot P10324 20-153
  8. 1032703Domain d2aizp1: 2aiz P:1-134 [126839]

Details for d2aizp1

PDB Entry: 2aiz (more details)

PDB Description: solution structure of peptidoglycan associated lipoprotein from haemophilus influenza bound to udp-n-acetylmuramoyl-l-alanyl-d- glutamyl-meso-2,6-diaminopimeloyl-d-alanyl-d-alanine
PDB Compounds: (P:) Outer membrane protein P6

SCOPe Domain Sequences for d2aizp1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aizp1 d.79.7.1 (P:1-134) Peptidoglycan-associated lipoprotein, PAL, periplasmic domain {Haemophilus influenzae [TaxId: 727]}
csssnndaagngaaqtfggysvadlqqryntvyfgfdkyditgeyvqildahaaylnatp
aakvlvegntdergtpeynialgqrradavkgylagkgvdagklgtvsygeekpavlghd
eaaysknrravlay

SCOPe Domain Coordinates for d2aizp1:

Click to download the PDB-style file with coordinates for d2aizp1.
(The format of our PDB-style files is described here.)

Timeline for d2aizp1: