![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
![]() | Superfamily d.79.7: OmpA-like [103088] (2 families) ![]() |
![]() | Family d.79.7.1: OmpA-like [103089] (3 proteins) Pfam PF00691 |
![]() | Protein Peptidoglycan-associated lipoprotein, PAL, periplasmic domain [103090] (2 species) |
![]() | Species Haemophilus influenzae [TaxId:727] [143531] (1 PDB entry) Uniprot P10324 20-153 |
![]() | Domain d2aizp1: 2aiz P:1-134 [126839] |
PDB Entry: 2aiz (more details)
SCOPe Domain Sequences for d2aizp1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aizp1 d.79.7.1 (P:1-134) Peptidoglycan-associated lipoprotein, PAL, periplasmic domain {Haemophilus influenzae [TaxId: 727]} csssnndaagngaaqtfggysvadlqqryntvyfgfdkyditgeyvqildahaaylnatp aakvlvegntdergtpeynialgqrradavkgylagkgvdagklgtvsygeekpavlghd eaaysknrravlay
Timeline for d2aizp1: