Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.190: Chorismate lyase-like [64287] (1 superfamily) duplication of alpha(2)-beta(3) motif; antiparallel beta sheet, order 123654 |
Superfamily d.190.1: Chorismate lyase-like [64288] (4 families) |
Family d.190.1.1: Chorismate lyase [64289] (1 protein) automatically mapped to Pfam PF04345 |
Protein Chorismate lyase [64290] (1 species) |
Species Escherichia coli [TaxId:562] [64291] (7 PDB entries) Uniprot P26602 |
Domain d2ahcc_: 2ahc C: [126750] automated match to d1fw9a_ complexed with vnl |
PDB Entry: 2ahc (more details), 2.4 Å
SCOPe Domain Sequences for d2ahcc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ahcc_ d.190.1.1 (C:) Chorismate lyase {Escherichia coli [TaxId: 562]} shpaltqlralryskeipaldpqlldwllledsmtkrfeqqgktvsvtmiregfveqnei peelpllpkesrywlreillsadgepwlagrtvvpvstlsgpelalqklgktplgrylft sstltrdfieigrdaglwgrrsrlrlsgkpllltelflpasply
Timeline for d2ahcc_: