Lineage for d2ahcc_ (2ahc C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3005715Fold d.190: Chorismate lyase-like [64287] (1 superfamily)
    duplication of alpha(2)-beta(3) motif; antiparallel beta sheet, order 123654
  4. 3005716Superfamily d.190.1: Chorismate lyase-like [64288] (4 families) (S)
  5. 3005717Family d.190.1.1: Chorismate lyase [64289] (1 protein)
    automatically mapped to Pfam PF04345
  6. 3005718Protein Chorismate lyase [64290] (1 species)
  7. 3005719Species Escherichia coli [TaxId:562] [64291] (7 PDB entries)
    Uniprot P26602
  8. 3005729Domain d2ahcc_: 2ahc C: [126750]
    automated match to d1fw9a_
    complexed with vnl

Details for d2ahcc_

PDB Entry: 2ahc (more details), 2.4 Å

PDB Description: chorismate lyase with inhibitor vanilate
PDB Compounds: (C:) chorismate lyase

SCOPe Domain Sequences for d2ahcc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ahcc_ d.190.1.1 (C:) Chorismate lyase {Escherichia coli [TaxId: 562]}
shpaltqlralryskeipaldpqlldwllledsmtkrfeqqgktvsvtmiregfveqnei
peelpllpkesrywlreillsadgepwlagrtvvpvstlsgpelalqklgktplgrylft
sstltrdfieigrdaglwgrrsrlrlsgkpllltelflpasply

SCOPe Domain Coordinates for d2ahcc_:

Click to download the PDB-style file with coordinates for d2ahcc_.
(The format of our PDB-style files is described here.)

Timeline for d2ahcc_: