![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.190: Chorismate lyase-like [64287] (1 superfamily) duplication of alpha(2)-beta(3) motif; antiparallel beta sheet, order 123654 |
![]() | Superfamily d.190.1: Chorismate lyase-like [64288] (4 families) ![]() |
![]() | Family d.190.1.1: Chorismate lyase [64289] (1 protein) automatically mapped to Pfam PF04345 |
![]() | Protein Chorismate lyase [64290] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [64291] (7 PDB entries) Uniprot P26602 |
![]() | Domain d2ahcd_: 2ahc D: [126751] automated match to d1fw9a_ complexed with vnl |
PDB Entry: 2ahc (more details), 2.4 Å
SCOPe Domain Sequences for d2ahcd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ahcd_ d.190.1.1 (D:) Chorismate lyase {Escherichia coli [TaxId: 562]} shpaltqlralryskeipaldpqlldwllledsmtkrfeqqgktvsvtmiregfveqnei peelpllpkesrywlreillsadgepwlagrtvvpvstlsgpelalqklgktplgrylft sstltrdfieigrdaglwgrrsrlrlsgkpllltelflpasply
Timeline for d2ahcd_: