![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.190: Chorismate lyase-like [64287] (1 superfamily) duplication of alpha(2)-beta(3) motif; antiparallel beta sheet, order 123654 |
![]() | Superfamily d.190.1: Chorismate lyase-like [64288] (2 families) ![]() |
![]() | Family d.190.1.1: Chorismate lyase [64289] (1 protein) |
![]() | Protein Chorismate lyase [64290] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [64291] (7 PDB entries) |
![]() | Domain d2ahcc1: 2ahc C:1-164 [126750] automatically matched to d1fw9a_ complexed with vnl; mutant |
PDB Entry: 2ahc (more details), 2.4 Å
SCOP Domain Sequences for d2ahcc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ahcc1 d.190.1.1 (C:1-164) Chorismate lyase {Escherichia coli [TaxId: 562]} shpaltqlralryskeipaldpqlldwllledsmtkrfeqqgktvsvtmiregfveqnei peelpllpkesrywlreillsadgepwlagrtvvpvstlsgpelalqklgktplgrylft sstltrdfieigrdaglwgrrsrlrlsgkpllltelflpasply
Timeline for d2ahcc1: