SCOP 1.73: Domain d2ah7x1: 2ah7 X:0-179

Lineage for d2ah7x1 (2ah7 X:0-179)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (8 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (20 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein Nitrophorin 2 (prolixin-s) [50843] (1 species)

7. Species Rhodnius prolixus [TaxId:13249] [50844] (14 PDB entries)

8. Domain d2ah7x1: 2ah7 X:0-179 [126743]
   automatically matched to d1euoa_
   complexed with hem

Details for d2ah7x1

PDB Entry: 2ah7, 1.7 Å

PDB Description: Crystal structure of nitrophorin 2 aqua complex

PDB Compounds: (X:) Nitrophorin 2

SCOP Domain Sequences for d2ah7x1:

Sequence; same for both SEQRES and ATOM records:

>d2ah7x1 b.60.1.1 (X:0-179) Nitrophorin 2 (prolixin-s) {Rhodnius prolixus [TaxId: 13249]}
mdcstnispkqgldkakyfsgkwyvthfldkdpqvtdqycssftpresdgtvkealyhyn
ankktsfynigegklessglqytakyktvdkkkavlkeadeknsytltvleaddssalvh
iclregskdlgdlytvlthqkdaepsakvksavtqaglqlsqfvgtkdlgcqyddqftsl

Timeline for d2ah7x1:

• d2ah7x1 is new in SCOP 1.73
  
• d2ah7x1 appears in SCOP 1.75
  
• d2ah7x1 appears in the current release, SCOPe 2.08, called d2ah7x2