Lineage for d1euoa_ (1euo A:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 673645Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 673646Superfamily b.60.1: Lipocalins [50814] (8 families) (S)
    bind hydrophobic ligands in their interior
  5. 673647Family b.60.1.1: Retinol binding protein-like [50815] (20 proteins)
    barrel, closed; n=8, S=12, meander
  6. 673795Protein Nitrophorin 2 (prolixin-s) [50843] (1 species)
  7. 673796Species Rhodnius prolixus [TaxId:13249] [50844] (14 PDB entries)
  8. 673810Domain d1euoa_: 1euo A: [27163]
    complexed with hem, nh3

Details for d1euoa_

PDB Entry: 1euo (more details), 2 Å

PDB Description: crystal structure of nitrophorin 2 (prolixin-s)
PDB Compounds: (A:) Nitrophorin 2

SCOP Domain Sequences for d1euoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1euoa_ b.60.1.1 (A:) Nitrophorin 2 (prolixin-s) {Rhodnius prolixus [TaxId: 13249]}
mdcstnispkqgldkakyfsgkwyvthfldkdpqvtdqycssftpresdgtvkealyhyn
ankktsfynigegklessglqytakyktvdkkkavlkeadeknsytltvleaddssalvh
iclregskdlgdlytvlthqkdaepsakvksavtqaglqlsqfvgtkdlgcqyddqftsl

SCOP Domain Coordinates for d1euoa_:

Click to download the PDB-style file with coordinates for d1euoa_.
(The format of our PDB-style files is described here.)

Timeline for d1euoa_: