Lineage for d1euoa_ (1euo A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 16455Fold b.60: Lipocalins [50813] (1 superfamily)
  4. 16456Superfamily b.60.1: Lipocalins [50814] (3 families) (S)
  5. 16457Family b.60.1.1: Retinol binding protein-like [50815] (12 proteins)
  6. 16521Protein Nitrophorin 2 (prolixin-s) [50843] (1 species)
  7. 16522Species Rhodnius prolixus [TaxId:13249] [50844] (1 PDB entry)
  8. 16523Domain d1euoa_: 1euo A: [27163]

Details for d1euoa_

PDB Entry: 1euo (more details), 2 Å

PDB Description: crystal structure of nitrophorin 2 (prolixin-s)

SCOP Domain Sequences for d1euoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1euoa_ b.60.1.1 (A:) Nitrophorin 2 (prolixin-s) {Rhodnius prolixus}
mdcstnispkqgldkakyfsgkwyvthfldkdpqvtdqycssftpresdgtvkealyhyn
ankktsfynigegklessglqytakyktvdkkkavlkeadeknsytltvleaddssalvh
iclregskdlgdlytvlthqkdaepsakvksavtqaglqlsqfvgtkdlgcqyddqftsl

SCOP Domain Coordinates for d1euoa_:

Click to download the PDB-style file with coordinates for d1euoa_.
(The format of our PDB-style files is described here.)

Timeline for d1euoa_: