SCOPe 2.01: Domain d2afhf_: 2afh F:

Lineage for d2afhf_ (2afh F:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
   core: parallel beta-sheet of 7 strands; order 3241567

6. Protein Nitrogenase iron protein [52661] (2 species)

7. Species Azotobacter vinelandii [TaxId:354] [52662] (19 PDB entries)

8. Domain d2afhf_: 2afh F: [126684]
   Other proteins in same PDB: d2afha_, d2afhb_, d2afhc_, d2afhd_
   automated match to d1de0a_
   complexed with 1pe, ca, cfn, clf, hca, na, p6g, peg, pg4, pge, sf4, trs

Details for d2afhf_

PDB Entry: 2afh, 2.1 Å

PDB Description: crystal structure of nucleotide-free av2-av1 complex

PDB Compounds: (F:) nitrogenase iron protein 1

SCOPe Domain Sequences for d2afhf_:

Sequence; same for both SEQRES and ATOM records:

>d2afhf_ c.37.1.10 (F:) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]}
amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem
aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
fvfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
ralarkvvdnkllvipnpitmdeleellmefgimevedesivgkta

Timeline for d2afhf_:

• d2afhf_ first appeared in SCOP 1.73, called d2afhf1
  
• d2afhf_ was called d2afhf1 in SCOP 1.75
  
• d2afhf_ appears in SCOPe 2.02
  
• d2afhf_ appears in the current release, SCOPe 2.08