Lineage for d2afhf1 (2afh F:1-286)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 695085Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 695086Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 696576Family c.37.1.10: Nitrogenase iron protein-like [52652] (13 proteins)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 696764Protein Nitrogenase iron protein [52661] (2 species)
  7. 696765Species Azotobacter vinelandii [TaxId:354] [52662] (15 PDB entries)
  8. 696767Domain d2afhf1: 2afh F:1-286 [126684]
    Other proteins in same PDB: d2afha1, d2afhb1, d2afhc1, d2afhd1
    automatically matched to d1fp6a_
    complexed with 1pe, ca, cfn, clf, hca, na, p6g, peg, pg4, pge, sf4, trs

Details for d2afhf1

PDB Entry: 2afh (more details), 2.1 Å

PDB Description: Crystal Structure of Nucleotide-Free Av2-Av1 Complex
PDB Compounds: (F:) nitrogenase iron protein 1

SCOP Domain Sequences for d2afhf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2afhf1 c.37.1.10 (F:1-286) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]}
amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem
aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
fvfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
ralarkvvdnkllvipnpitmdeleellmefgimevedesivgkta

SCOP Domain Coordinates for d2afhf1:

Click to download the PDB-style file with coordinates for d2afhf1.
(The format of our PDB-style files is described here.)

Timeline for d2afhf1: