Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (9 families) |
Family c.67.1.8: SelA-like [142683] (1 protein) Pfam PF03841 |
Protein Hypothetical protein MJ0158 [142684] (1 species) |
Species Archaeon Methanococcus jannaschii [TaxId:2190] [142685] (2 PDB entries) Uniprot Q57622 9-374 |
Domain d2aeva1: 2aev A:9-374 [126647] automatically matched to 2AEU A:9-374 complexed with so4 |
PDB Entry: 2aev (more details), 2 Å
SCOP Domain Sequences for d2aeva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aeva1 c.67.1.8 (A:9-374) Hypothetical protein MJ0158 {Archaeon Methanococcus jannaschii [TaxId: 2190]} lrlekarkiileilnekgrdalydlsglsggflidekdkallntyigssyfaekvneygl khlggdendkcvgfnrtssailatilalkpkkvihylpelpghpsiersckivnakyfes dkvgeilnkidkdtlviitgstmdlkvielenfkkvintaknkeaivfvddasgarvrll fnqppalklgadlvvtstdklmegprggllagkkelvdkiyiegtkfgleaqppllagiy ralknfnlerirkaferaknfdlskieklnkelkaiddninivyertptgfvikrvykdd tinikklieigfnllknygiititvagmpgaskslridltsrdaeriddnyiikaivesi kmafks
Timeline for d2aeva1: