Lineage for d2aeva_ (2aev A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132202Family c.67.1.8: SelA-like [142683] (1 protein)
    Pfam PF03841
  6. 2132203Protein Hypothetical protein MJ0158 [142684] (1 species)
  7. 2132204Species Methanococcus jannaschii [TaxId:2190] [142685] (2 PDB entries)
    Uniprot Q57622 9-374
  8. 2132206Domain d2aeva_: 2aev A: [126647]
    automated match to d2aeua1
    complexed with so4

Details for d2aeva_

PDB Entry: 2aev (more details), 2 Å

PDB Description: MJ0158, NaBH4-reduced form
PDB Compounds: (A:) Hypothetical protein MJ0158

SCOPe Domain Sequences for d2aeva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aeva_ c.67.1.8 (A:) Hypothetical protein MJ0158 {Methanococcus jannaschii [TaxId: 2190]}
lrlekarkiileilnekgrdalydlsglsggflidekdkallntyigssyfaekvneygl
khlggdendkcvgfnrtssailatilalkpkkvihylpelpghpsiersckivnakyfes
dkvgeilnkidkdtlviitgstmdlkvielenfkkvintaknkeaivfvddasgarvrll
fnqppalklgadlvvtstdklmegprggllagkkelvdkiyiegtkfgleaqppllagiy
ralknfnlerirkaferaknfdlskieklnkelkaiddninivyertptgfvikrvykdd
tinikklieigfnllknygiititvagmpgaskslridltsrdaeriddnyiikaivesi
kmafks

SCOPe Domain Coordinates for d2aeva_:

Click to download the PDB-style file with coordinates for d2aeva_.
(The format of our PDB-style files is described here.)

Timeline for d2aeva_: