Lineage for d2aeva1 (2aev A:9-374)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 705327Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 705328Superfamily c.67.1: PLP-dependent transferases [53383] (8 families) (S)
  5. 706180Family c.67.1.8: SelA-like [142683] (1 protein)
    Pfam PF03841
  6. 706181Protein Hypothetical protein MJ0158 [142684] (1 species)
  7. 706182Species Archaeon Methanococcus jannaschii [TaxId:2190] [142685] (2 PDB entries)
  8. 706184Domain d2aeva1: 2aev A:9-374 [126647]
    automatically matched to 2AEU A:9-374
    complexed with so4

Details for d2aeva1

PDB Entry: 2aev (more details), 2 Å

PDB Description: MJ0158, NaBH4-reduced form
PDB Compounds: (A:) Hypothetical protein MJ0158

SCOP Domain Sequences for d2aeva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aeva1 c.67.1.8 (A:9-374) Hypothetical protein MJ0158 {Archaeon Methanococcus jannaschii [TaxId: 2190]}
lrlekarkiileilnekgrdalydlsglsggflidekdkallntyigssyfaekvneygl
khlggdendkcvgfnrtssailatilalkpkkvihylpelpghpsiersckivnakyfes
dkvgeilnkidkdtlviitgstmdlkvielenfkkvintaknkeaivfvddasgarvrll
fnqppalklgadlvvtstdklmegprggllagkkelvdkiyiegtkfgleaqppllagiy
ralknfnlerirkaferaknfdlskieklnkelkaiddninivyertptgfvikrvykdd
tinikklieigfnllknygiititvagmpgaskslridltsrdaeriddnyiikaivesi
kmafks

SCOP Domain Coordinates for d2aeva1:

Click to download the PDB-style file with coordinates for d2aeva1.
(The format of our PDB-style files is described here.)

Timeline for d2aeva1: