Class b: All beta proteins [48724] (174 folds) |
Fold b.55: PH domain-like barrel [50728] (2 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (14 families) |
Family b.55.1.5: Third domain of FERM [50776] (8 proteins) |
Protein Focal adhesion kinase 1 [141432] (1 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [141433] (3 PDB entries) Uniprot Q00944 254-363 |
Domain d2aeha2: 2aeh A:254-363 [126626] Other proteins in same PDB: d2aeha1, d2aeha3, d2aehb1, d2aehb3 automatically matched to 2AL6 A:254-363 |
PDB Entry: 2aeh (more details), 2.53 Å
SCOPe Domain Sequences for d2aeha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aeha2 b.55.1.5 (A:254-363) Focal adhesion kinase 1 {Chicken (Gallus gallus) [TaxId: 9031]} dkecfkcalgsswiisvelaigpeegisyltdkganpthladfnqvqtiqysnsedkdrk gmlqlkiagapepltvtapsltiaenmadlidgycrlvngatqsfiirpq
Timeline for d2aeha2: