Lineage for d2aeha1 (2aeh A:131-253)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 908855Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
    core: 3 helices; bundle, closed, left-handed twist; up-and-down
  4. 908888Superfamily a.11.2: Second domain of FERM [47031] (1 family) (S)
  5. 908889Family a.11.2.1: Second domain of FERM [47032] (8 proteins)
  6. 908899Protein Focal adhesion kinase 1 [140380] (1 species)
  7. 908900Species Chicken (Gallus gallus) [TaxId:9031] [140381] (3 PDB entries)
    Uniprot Q00944 131-253
  8. 908903Domain d2aeha1: 2aeh A:131-253 [126625]
    Other proteins in same PDB: d2aeha2, d2aeha3, d2aehb2, d2aehb3
    automatically matched to 2AL6 A:131-253

Details for d2aeha1

PDB Entry: 2aeh (more details), 2.53 Å

PDB Description: Focal adhesion kinase 1
PDB Compounds: (A:) Focal adhesion kinase 1

SCOPe Domain Sequences for d2aeha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aeha1 a.11.2.1 (A:131-253) Focal adhesion kinase 1 {Chicken (Gallus gallus) [TaxId: 9031]}
kgflnqftedkptlnffyqqvkndymleiadqvdqeialklgcleirrsygemrgnalek
ksnyevlekdvglrrffpkslldsvkaktlrkliqqtfrqfanlnreesilkffeilspv
yrf

SCOPe Domain Coordinates for d2aeha1:

Click to download the PDB-style file with coordinates for d2aeha1.
(The format of our PDB-style files is described here.)

Timeline for d2aeha1: