SCOPe 2.08: Domain d2ae9a_: 2ae9 A:

Lineage for d2ae9a_ (2ae9 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.237: DNA polymerase III theta subunit-like [116730] (1 superfamily)
   3 helices; irregular array

4. Superfamily a.237.1: DNA polymerase III theta subunit-like [46575] (1 family)
   automatically mapped to Pfam PF06440

5. Family a.237.1.1: DNA polymerase III theta subunit-like [46576] (2 proteins)
   Pfam PF06440
   independent solution structure determinations of different members resulted in similar secondary structures but different folds

6. Protein Theta subunit of DNA polymerase III [46577] (1 species)

7. Species Escherichia coli [TaxId:562] [46578] (4 PDB entries)

8. Domain d2ae9a_: 2ae9 A: [126616]
   automated match to d2ae9a1

Details for d2ae9a_

PDB Entry: 2ae9

PDB Description: solution structure of the theta subunit of dna polymerase iii from e. coli

PDB Compounds: (A:) DNA polymerase III, theta subunit

SCOPe Domain Sequences for d2ae9a_:

Sequence; same for both SEQRES and ATOM records:

>d2ae9a_ a.237.1.1 (A:) Theta subunit of DNA polymerase III {Escherichia coli [TaxId: 562]}
mlknlakldqtemdkvnvdlaaagvafkerynmpviaeavereqpehlrswfrerliahr
lasvnlsrlpyepklk

Timeline for d2ae9a_:

• d2ae9a_ first appeared in SCOP 1.73, called d2ae9a1
  
• d2ae9a_ appears in SCOPe 2.07