Lineage for d2ae9a_ (2ae9 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2015810Fold a.237: DNA polymerase III theta subunit-like [116730] (1 superfamily)
    3 helices; irregular array
  4. 2015811Superfamily a.237.1: DNA polymerase III theta subunit-like [46575] (1 family) (S)
    automatically mapped to Pfam PF06440
  5. 2015812Family a.237.1.1: DNA polymerase III theta subunit-like [46576] (2 protein domains)
    Pfam PF06440
    independent solution structure determinations of different members resulted in similar secondary structures but different folds
  6. 2015818Protein Theta subunit of DNA polymerase III [46577] (1 species)
  7. 2015819Species Escherichia coli [TaxId:562] [46578] (4 PDB entries)
  8. 2015821Domain d2ae9a_: 2ae9 A: [126616]
    automated match to d2ae9a1

Details for d2ae9a_

PDB Entry: 2ae9 (more details)

PDB Description: Solution Structure of the theta subunit of DNA polymerase III from E. coli
PDB Compounds: (A:) DNA polymerase III, theta subunit

SCOPe Domain Sequences for d2ae9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ae9a_ a.237.1.1 (A:) Theta subunit of DNA polymerase III {Escherichia coli [TaxId: 562]}
mlknlakldqtemdkvnvdlaaagvafkerynmpviaeavereqpehlrswfrerliahr
lasvnlsrlpyepklk

SCOPe Domain Coordinates for d2ae9a_:

Click to download the PDB-style file with coordinates for d2ae9a_.
(The format of our PDB-style files is described here.)

Timeline for d2ae9a_: