PDB entry 2ae9

View 2ae9 on RCSB PDB site
Description: Solution Structure of the theta subunit of DNA polymerase III from E. coli
Class: transferase
Keywords: all helical, 3 helices, TRANSFERASE
Deposited on 2005-07-21, released 2005-10-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase III, theta subunit
    Species: Escherichia coli [TaxId:562]
    Gene: holE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2ae9a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ae9A (A:)
    mlknlakldqtemdkvnvdlaaagvafkerynmpviaeavereqpehlrswfrerliahr
    lasvnlsrlpyepklk