Lineage for d2aczb2 (2acz B:1-106)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1892544Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1894040Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 1894211Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins)
  6. 1894368Protein automated matches [231466] (4 species)
    not a true protein
  7. 1894395Species Escherichia coli [TaxId:562] [231467] (2 PDB entries)
  8. 1894399Domain d2aczb2: 2acz B:1-106 [126565]
    Other proteins in same PDB: d2aczb1, d2aczc_, d2aczd1
    automated match to d2wdqb1
    complexed with at5, cdn, f3s, fad, fes, heb, oaa, sf4

Details for d2aczb2

PDB Entry: 2acz (more details), 3.1 Å

PDB Description: Complex II (Succinate Dehydrogenase) From E. Coli with Atpenin A5 inhibitor co-crystallized at the ubiquinone binding site
PDB Compounds: (B:) Succinate dehydrogenase iron-sulfur protein

SCOPe Domain Sequences for d2aczb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aczb2 d.15.4.2 (B:1-106) automated matches {Escherichia coli [TaxId: 562]}
mrlefsiyrynpdvddaprmqdytleadegrdmmlldaliqlkekdpslsfrrscregvc
gsdglnmngknglacitpisalnqpgkkivirplpglpvirdlvvd

SCOPe Domain Coordinates for d2aczb2:

Click to download the PDB-style file with coordinates for d2aczb2.
(The format of our PDB-style files is described here.)

Timeline for d2aczb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2aczb1