![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) ![]() |
![]() | Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins) |
![]() | Protein automated matches [231466] (5 species) not a true protein |
![]() | Species Escherichia coli [TaxId:562] [231467] (2 PDB entries) |
![]() | Domain d2aczb2: 2acz B:1-106 [126565] Other proteins in same PDB: d2aczb1, d2aczc_, d2aczd1 automated match to d2wdqb1 complexed with at5, cdn, f3s, fad, fes, heb, oaa, sf4 |
PDB Entry: 2acz (more details), 3.1 Å
SCOPe Domain Sequences for d2aczb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aczb2 d.15.4.2 (B:1-106) automated matches {Escherichia coli [TaxId: 562]} mrlefsiyrynpdvddaprmqdytleadegrdmmlldaliqlkekdpslsfrrscregvc gsdglnmngknglacitpisalnqpgkkivirplpglpvirdlvvd
Timeline for d2aczb2: