SCOP 1.73: Domain d2aczb2: 2acz B:1-106

Lineage for d2aczb2 (2acz B:1-106)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families)

5. Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (13 proteins)

6. Protein Succinate dehydogenase iron-sulfur protein, N-terminal domain [82586] (1 species)

7. Species Escherichia coli [TaxId:562] [82587] (3 PDB entries)

8. Domain d2aczb2: 2acz B:1-106 [126565]
   Other proteins in same PDB: d2aczb1, d2aczc1, d2aczd1
   automatically matched to d1nekb2
   complexed with at5, cdn, f3s, fad, fes, heb, oaa, sf4

Details for d2aczb2

PDB Entry: 2acz, 3.1 Å

PDB Description: Complex II (Succinate Dehydrogenase) From E. Coli with Atpenin A5 inhibitor co-crystallized at the ubiquinone binding site

PDB Compounds: (B:) Succinate dehydrogenase iron-sulfur protein

SCOP Domain Sequences for d2aczb2:

Sequence; same for both SEQRES and ATOM records:

>d2aczb2 d.15.4.2 (B:1-106) Succinate dehydogenase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]}
mrlefsiyrynpdvddaprmqdytleadegrdmmlldaliqlkekdpslsfrrscregvc
gsdglnmngknglacitpisalnqpgkkivirplpglpvirdlvvd

Timeline for d2aczb2:

• d2aczb2 is new in SCOP 1.73
  
• d2aczb2 appears in SCOP 1.75
  
• d2aczb2 appears in the current release, SCOPe 2.08