SCOP 1.73: Domain d2aczb1: 2acz B:107-238

Lineage for d2aczb1 (2acz B:107-238)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.2: alpha-helical ferredoxin [46548] (2 families)
   contains two Fe4-S4 clusters

5. Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (2 proteins)

6. Protein Succinate dehydogenase [81669] (1 species)

7. Species Escherichia coli [TaxId:562] [81670] (3 PDB entries)

8. Domain d2aczb1: 2acz B:107-238 [126564]
   Other proteins in same PDB: d2aczb2, d2aczc1, d2aczd1
   automatically matched to d1nekb1
   complexed with at5, cdn, f3s, fad, fes, heb, oaa, sf4

Details for d2aczb1

PDB Entry: 2acz, 3.1 Å

PDB Description: Complex II (Succinate Dehydrogenase) From E. Coli with Atpenin A5 inhibitor co-crystallized at the ubiquinone binding site

PDB Compounds: (B:) Succinate dehydrogenase iron-sulfur protein

SCOP Domain Sequences for d2aczb1:

Sequence; same for both SEQRES and ATOM records:

>d2aczb1 a.1.2.1 (B:107-238) Succinate dehydogenase {Escherichia coli [TaxId: 562]}
mgqfyaqyekikpyllnngqnpparehlqmpeqrekldglyecilcaccstscpsfwwnp
dkfigpagllaayrflidsrdtetdsrldglsdafsvfrchsimncvsvcpkglnptrai
ghiksmllqrna

Timeline for d2aczb1:

• d2aczb1 is new in SCOP 1.73
  
• d2aczb1 appears in SCOP 1.75
  
• d2aczb1 appears in the current release, SCOPe 2.08